Protein Info for GFF2989 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: TRAP-type C4-dicarboxylate transport system, large permease component

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 426 signal peptide" amino acids 1 to 34 (34 residues), see Phobius details transmembrane" amino acids 52 to 70 (19 residues), see Phobius details amino acids 91 to 117 (27 residues), see Phobius details amino acids 167 to 191 (25 residues), see Phobius details amino acids 216 to 235 (20 residues), see Phobius details amino acids 241 to 257 (17 residues), see Phobius details amino acids 268 to 293 (26 residues), see Phobius details amino acids 312 to 330 (19 residues), see Phobius details amino acids 335 to 353 (19 residues), see Phobius details amino acids 355 to 384 (30 residues), see Phobius details amino acids 399 to 420 (22 residues), see Phobius details PF06808: DctM" amino acids 6 to 415 (410 residues), 338.5 bits, see alignment E=2.8e-105 TIGR00786: TRAP transporter, DctM subunit" amino acids 16 to 421 (406 residues), 379 bits, see alignment E=1.2e-117

Best Hits

Swiss-Prot: 36% identical to YGIK_SALTY: Uncharacterized protein YgiK (ygiK) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: None (inferred from 58% identity to pol:Bpro_0555)

Predicted SEED Role

"TRAP-type C4-dicarboxylate transport system, large permease component"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (426 amino acids)

>GFF2989 TRAP-type C4-dicarboxylate transport system, large permease component (Hydrogenophaga sp. GW460-11-11-14-LB1)
MTLLVICVFCLLAFAGMPLAFALGFASLAALYAADFELVMLSQRMLHAVDNFPLMAIPLF
MLAGELMVKAGMMERLVTFANSLVGRVHGGLAHVTIIAGTILASVSGAAVASASALGSAL
VPSLRKHYPDSFNCAVIASAANLGPVIPPSNAMIVYALMAGSSVSVGGLFMAGIVPGVLL
ALGFIGIASFISWKRKYPPTGEAFNARNAWVQFRKAHIILFMPIIVVGGIIGGVFTATEG
AAIAVVYSGLVGLLITRKLRFADLPGCLFRAAVTASMVGALIALAATVTFLLTIDMVPQQ
MADFVKGMTSDPMVFVLLTMLLLVVVGMFLESNAAYIMLVPLFVPIADAFGLDPLWFGFL
FMFNLVIGMMTPPVGVLFFVMSGITRVPMGAIIRESMPFVIFQFAMLLLCVAFPSIVTAL
PRALGF