Protein Info for GFF2986 in Xanthobacter sp. DMC5

Annotation: Potassium-transporting ATPase potassium-binding subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 569 transmembrane" amino acids 6 to 27 (22 residues), see Phobius details amino acids 63 to 85 (23 residues), see Phobius details amino acids 138 to 156 (19 residues), see Phobius details amino acids 177 to 198 (22 residues), see Phobius details amino acids 257 to 275 (19 residues), see Phobius details amino acids 285 to 305 (21 residues), see Phobius details amino acids 329 to 350 (22 residues), see Phobius details amino acids 357 to 376 (20 residues), see Phobius details amino acids 382 to 401 (20 residues), see Phobius details amino acids 422 to 446 (25 residues), see Phobius details amino acids 485 to 508 (24 residues), see Phobius details amino acids 528 to 551 (24 residues), see Phobius details TIGR00680: K+-transporting ATPase, A subunit" amino acids 1 to 560 (560 residues), 781.5 bits, see alignment E=2.4e-239 PF03814: KdpA" amino acids 11 to 559 (549 residues), 822.1 bits, see alignment E=8.4e-252

Best Hits

Swiss-Prot: 83% identical to KDPA_BRADU: Potassium-transporting ATPase potassium-binding subunit (kdpA) from Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110)

KEGG orthology group: K01546, K+-transporting ATPase ATPase A chain [EC: 3.6.3.12] (inferred from 86% identity to xau:Xaut_3240)

MetaCyc: 59% identical to K+ transporting P-type ATPase subunit KdpA (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-2 [EC: 7.2.2.6]

Predicted SEED Role

"Potassium-transporting ATPase A chain (EC 3.6.3.12) (TC 3.A.3.7.1)" in subsystem Potassium homeostasis (EC 3.6.3.12, TC 3.A.3.7.1)

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.12

Use Curated BLAST to search for 3.6.3.12 or 7.2.2.6

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (569 amino acids)

>GFF2986 Potassium-transporting ATPase potassium-binding subunit (Xanthobacter sp. DMC5)
MTPNGWIQIALFCAIILALTPLLGGYMTRVFAGERTFLSPVLRPIEGAIFALGGVDPKRE
QTWLGYTLAMLLFHVAGFLILYAVLRLQDLLPLNPQEMAAMPPDLSLNTAISFLTNTNWQ
NYGGESTLSYLAQMLGLTHQNFLSAATGIALALALIRGFSRASAQTVGNFWVDVTRCTLY
VLLPLCIPYTLFLVWQGIPQTLGPYVDATTLEGAKQTIAVGPVASQVAIKMLGTNGGGFF
NANAAHPFENPTALSNFVQMISIFALGAGLTNVFGRMVGDERKGWAILAAMGVIFVAGVA
VTYWAEAAGTPGLNALGLTGGNMEGKELRFGIVASALFAVITTAASCGAVNAMHDSFTAL
GGMIPLINMELGEIIVGGVGAGMYGMLLFVVVAMFVAGLMVGRTPEYAGKKIEAKEVKMA
MLAILVLPLMMLGWTAVATVLPGTVAAISNPGPHGFSEILYAFTSATANNGSAFAGLSGN
TPFYNVTLAVSMFIGRFMMIVPAMALAGSLAAKKTVPASAGTFPTHGGLFVGLLVGVILI
VGGLTFFPALALGPIVEHLAAVAGQTFGG