Protein Info for GFF2980 in Xanthobacter sp. DMC5

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 transmembrane" amino acids 12 to 36 (25 residues), see Phobius details amino acids 48 to 71 (24 residues), see Phobius details amino acids 93 to 113 (21 residues), see Phobius details amino acids 120 to 139 (20 residues), see Phobius details amino acids 151 to 176 (26 residues), see Phobius details amino acids 197 to 218 (22 residues), see Phobius details amino acids 230 to 251 (22 residues), see Phobius details amino acids 272 to 295 (24 residues), see Phobius details PF05425: CopD" amino acids 192 to 293 (102 residues), 52.1 bits, see alignment E=3.9e-18

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (300 amino acids)

>GFF2980 hypothetical protein (Xanthobacter sp. DMC5)
VFPLILAARCTHFAAGLVLLGAPLFVFTAVPAWAGAAGASAMRAAERMVFLGLPVALVSA
LVWAGAALVDITGTPAGLADPNLVSGFLLETGFGRAMALRLAVLGVAAFAALALRGRRRL
AAIVAAGAVLMASESLLGHPGAAEGARAVMLVAVHAVHGMGAAVWIGGLLPLIVLLDGWA
KAAEEAGKAPGAVLRRFSRIGIGAVLMVGLGGGLAAILHIETPAALPGTIYGRIVILKAS
VFAGLVCLALRNRHIALRLARSPARGADLARIAVNSRVEVALALAAVFLAALLGMSDPQL