Protein Info for PS417_01520 in Pseudomonas simiae WCS417

Annotation: arsenic resistance protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 321 transmembrane" amino acids 12 to 32 (21 residues), see Phobius details amino acids 38 to 56 (19 residues), see Phobius details amino acids 68 to 88 (21 residues), see Phobius details amino acids 95 to 116 (22 residues), see Phobius details amino acids 126 to 146 (21 residues), see Phobius details amino acids 166 to 185 (20 residues), see Phobius details amino acids 197 to 219 (23 residues), see Phobius details amino acids 227 to 250 (24 residues), see Phobius details amino acids 262 to 282 (21 residues), see Phobius details amino acids 288 to 310 (23 residues), see Phobius details PF01758: SBF" amino acids 40 to 222 (183 residues), 60.6 bits, see alignment E=8.7e-21

Best Hits

KEGG orthology group: None (inferred from 87% identity to pfs:PFLU0318)

Predicted SEED Role

"Arsenical-resistance protein ACR3" in subsystem Arsenic resistance

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7TYN2 at UniProt or InterPro

Protein Sequence (321 amino acids)

>PS417_01520 arsenic resistance protein (Pseudomonas simiae WCS417)
MTRDVLEHNQIPVYFAAVLLAVGFGLFAPSFAQGLSVFVTPGIAVLMYAMFLQIPFLDVR
QSLSNKRFLSALLLANFILIPLLVWALTQSLAGRPALLVGALLVLLTPCIDYVVVFTHIG
KGDSRLMLAATPVLLLLQLALLPIYLSVMLGTQSAVVVEVGPFIEAFFLLIVVPMVLAVL
TTSLARQSSLVSAWNVAWAWMPVPAMALVLFVVIGSQIISVVRDINLLLPVIPVYIGFLL
LAPLMGALASRLFALPAVTARAVTFSASTRNSLVVLPLALALPEDVRGLAATAVILQTLV
ELVGELIYVRLIPKWVWPVGR