Protein Info for PS417_15225 in Pseudomonas simiae WCS417

Annotation: alpha/beta hydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 307 PF00561: Abhydrolase_1" amino acids 32 to 273 (242 residues), 104.2 bits, see alignment E=1.9e-33 PF12697: Abhydrolase_6" amino acids 34 to 281 (248 residues), 76.9 bits, see alignment E=7.4e-25 PF06342: DUF1057" amino acids 34 to 133 (100 residues), 21.9 bits, see alignment E=1.6e-08 PF12146: Hydrolase_4" amino acids 35 to 168 (134 residues), 56.2 bits, see alignment E=6.4e-19

Best Hits

KEGG orthology group: None (inferred from 92% identity to pfs:PFLU3536)

Predicted SEED Role

"Beta-ketoadipate enol-lactone hydrolase (EC 3.1.1.24)" in subsystem Catechol branch of beta-ketoadipate pathway or Chloroaromatic degradation pathway or Protocatechuate branch of beta-ketoadipate pathway (EC 3.1.1.24)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.1.1.24

Use Curated BLAST to search for 3.1.1.24

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7U7H7 at UniProt or InterPro

Protein Sequence (307 amino acids)

>PS417_15225 alpha/beta hydrolase (Pseudomonas simiae WCS417)
MTRRIEAAVPGSGRFVEVDGERFHYYEEGKGPPLLMIHGLMGSSRNLTYALSGQLREHFR
VITLDRPGSGYSTRHKGTAADLPAQARQVAAFINTLGLDKPIVLGHSLGGAISLALALDH
SHAVSGLVLVAPLTHPQPTLPLVFWSLAVRPAWLRRWVSHTLTVPMGLLTRRAVVKGVFA
PDSAPDDFATRGGGLLGMRPDNFYAASSEIALVNDDLPEMVKRYPQLTLPISLIYGAQDK
VLDFRKHGQALADKVPGLKLQLVEGRGHMLPITATARVVEAVQQLAKRARPAQTAAILHP
PFALTSQ