Protein Info for GFF2974 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Outer membrane stress sensor protease DegQ, serine protease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 455 signal peptide" amino acids 1 to 28 (28 residues), see Phobius details TIGR02037: peptidase Do" amino acids 41 to 453 (413 residues), 530 bits, see alignment E=2.3e-163 PF13365: Trypsin_2" amino acids 92 to 228 (137 residues), 107.6 bits, see alignment E=3e-34 PF00089: Trypsin" amino acids 93 to 252 (160 residues), 71.9 bits, see alignment E=2.2e-23 PF00595: PDZ" amino acids 263 to 345 (83 residues), 55.3 bits, see alignment E=2.2e-18 amino acids 375 to 443 (69 residues), 43.8 bits, see alignment E=8.5e-15 PF13180: PDZ_2" amino acids 278 to 358 (81 residues), 55.3 bits, see alignment E=1.9e-18 amino acids 384 to 449 (66 residues), 35.9 bits, see alignment E=2.2e-12 PF17820: PDZ_6" amino acids 293 to 347 (55 residues), 30.6 bits, see alignment 6.8e-11 amino acids 394 to 445 (52 residues), 32 bits, see alignment 2.5e-11

Best Hits

Swiss-Prot: 90% identical to DEGQ_ECOLI: Periplasmic pH-dependent serine endoprotease DegQ (degQ) from Escherichia coli (strain K12)

KEGG orthology group: K04772, serine protease DegQ [EC: 3.4.21.-] (inferred from 99% identity to sed:SeD_A3708)

MetaCyc: 90% identical to periplasmic serine endoprotease (Escherichia coli K-12 substr. MG1655)
3.4.21.-

Predicted SEED Role

"Outer membrane stress sensor protease DegQ, serine protease" in subsystem Proteolysis in bacteria, ATP-dependent

Isozymes

Compare fitness of predicted isozymes for: 3.4.21.-

Use Curated BLAST to search for 3.4.21.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (455 amino acids)

>GFF2974 Outer membrane stress sensor protease DegQ, serine protease (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MKKHTQLLSALALSVGLTLSAPFPALASIPGQVPGQATLPSLAPMLEKVLPAVVSVKVEG
TAAQSQKVPEEFKKFFGEDLPDQPSQPFEGLGSGVIIDAAKGYVLTNNHVINQAQKISIQ
LNDGREFDAKQIGGDDQSDIALLQIQNPSKLTQIAIADSDKLRVGDFAVAVGNPFGLGQT
ATSGIISALGRSGLNLEGLENFIQTDASINRGNSGGALLNLNGELIGINTAILAPGGGSI
GIGFAIPSNMAQTLAQQLIQFGEIKRGLLGIKGTEMTADIAKAFKLNVQRGAFVSEVLPN
SGSAKAGVKSGDVIISLNGKQLNSFAELRSRIATTEPGTKVKLGLLRDGKPLEVEVTLDS
NTSSSASAEMIAPALQGATLSDGQLKDGTKGVKVDSVEKSSPAAQAGLQKDDVIIGVNRD
RISSIAEMRKVMAAKPSIIALQVVRGNENIYLLLR