Protein Info for GFF2972 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: TRAP-type C4-dicarboxylate transport system, large permease component

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 423 transmembrane" amino acids 6 to 36 (31 residues), see Phobius details amino acids 48 to 71 (24 residues), see Phobius details amino acids 96 to 124 (29 residues), see Phobius details amino acids 136 to 163 (28 residues), see Phobius details amino acids 172 to 195 (24 residues), see Phobius details amino acids 216 to 235 (20 residues), see Phobius details amino acids 241 to 260 (20 residues), see Phobius details amino acids 272 to 294 (23 residues), see Phobius details amino acids 314 to 346 (33 residues), see Phobius details amino acids 358 to 385 (28 residues), see Phobius details amino acids 397 to 422 (26 residues), see Phobius details PF06808: DctM" amino acids 11 to 417 (407 residues), 350 bits, see alignment E=8.8e-109 TIGR00786: TRAP transporter, DctM subunit" amino acids 19 to 421 (403 residues), 400.4 bits, see alignment E=4e-124

Best Hits

Swiss-Prot: 42% identical to DCTM_PSEAE: C4-dicarboxylate TRAP transporter large permease protein DctM (dctM) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: None (inferred from 68% identity to put:PT7_3249)

Predicted SEED Role

"TRAP-type C4-dicarboxylate transport system, large permease component"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (423 amino acids)

>GFF2972 TRAP-type C4-dicarboxylate transport system, large permease component (Hydrogenophaga sp. GW460-11-11-14-LB1)
MSLTSWILTAGFAGLAALGMPFAFAIGLCVIAVVLSVGIEPMLFPQTVVAGTQSFSLLAI
PFFMLAGELMSAGGLSQRLVRVAEVFVRHLPGGMDLAVVLAALVFAAVSGSAPATTAAIG
AVMIPAMVARGYDKAYATALVVSAGVLAPLIPPSIAFVIWGVIAEQSISRLFLSGVLPGL
LMALGMAVIAVSRALRSPIPREPRASLREIGTALREGVWALLAPVVVLGGIYGGAFTPTE
AAVVACVYALFIGVVVERRLKLSQLPGIISKGMAISAIVMAIVAVSNGFSFLIAQEQLAG
KLAAWLALHFHERWTMLLALNVGFFLLAAVMDEVAIMVILGPMLIGIANQFGVDPIHFGA
MIVTNVAIGMAAPPIGYCLFVGMAVSGLKLWPVARAILPFVAMMLVVLVLVTYVPAFALL
LVP