Protein Info for GFF297 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Integral membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 286 transmembrane" amino acids 12 to 32 (21 residues), see Phobius details amino acids 39 to 60 (22 residues), see Phobius details amino acids 66 to 86 (21 residues), see Phobius details amino acids 98 to 118 (21 residues), see Phobius details amino acids 123 to 142 (20 residues), see Phobius details amino acids 150 to 167 (18 residues), see Phobius details amino acids 179 to 198 (20 residues), see Phobius details amino acids 216 to 234 (19 residues), see Phobius details amino acids 240 to 261 (22 residues), see Phobius details amino acids 267 to 285 (19 residues), see Phobius details PF00892: EamA" amino acids 149 to 283 (135 residues), 46 bits, see alignment E=3.3e-16

Best Hits

KEGG orthology group: None (inferred from 100% identity to sek:SSPA3406)

Predicted SEED Role

"Integral membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (286 amino acids)

>GFF297 Integral membrane protein (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MTPSTTPDAMTLSVFCILLFAALLHASWNAIVKAGNDKLYAAIGVSGSAAVMALILLPFS
PQPAHASIPFLAASTALQVVYTVLVAKTYQVSDMSQTYPLMRGTAPLLVALISVLFLGDS
LSSLAWVGIAVICMAILGMACNGRASSQRGVVLALTNACFIAGYTLVDGTGVRLSETALG
YTLWSFFLNGACLLTWAMIARRREASRYLAQQWKKGIFGGIGTMGSYGLALWAMTQAPLA
VVAALRETSILFGALIAWLLLKEKVAGLRLVAAGGIALGAILLRLS