Protein Info for GFF296 in Variovorax sp. SCN45

Annotation: Septum formation protein Maf

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 PF02545: Maf" amino acids 5 to 194 (190 residues), 181.4 bits, see alignment E=7.2e-58 TIGR00172: septum formation protein Maf" amino acids 5 to 194 (190 residues), 146 bits, see alignment E=4.6e-47

Best Hits

Swiss-Prot: 72% identical to NTPPA_RHOFT: dTTP/UTP pyrophosphatase (Rfer_2081) from Rhodoferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118)

KEGG orthology group: K06287, septum formation protein (inferred from 83% identity to vpe:Varpa_2714)

Predicted SEED Role

"Septum formation protein Maf" in subsystem Bacterial Cell Division or Bacterial Cytoskeleton

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (200 amino acids)

>GFF296 Septum formation protein Maf (Variovorax sp. SCN45)
LSDFIYLASQSPRRAQLLGQLGIRHALLLADASEDAESLEAVLPNEAPASYVQRVTALKL
DAAVARLQRRGLASAPVLCADTTVALGRTILGKPEDAADAARMLAMLSGAMHRVLTAVAL
QDGDRRLAALSVSRVRFAKVTEAQIARYAESGEPLGKAGAYAIQGAAAAFIEHISGSYSG
IMGLPMFETAELLRGAGFNT