Protein Info for PS417_01505 in Pseudomonas simiae WCS417

Annotation: gamma-aminobutyrate transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 463 transmembrane" amino acids 21 to 41 (21 residues), see Phobius details amino acids 47 to 66 (20 residues), see Phobius details amino acids 86 to 105 (20 residues), see Phobius details amino acids 124 to 144 (21 residues), see Phobius details amino acids 155 to 178 (24 residues), see Phobius details amino acids 199 to 221 (23 residues), see Phobius details amino acids 241 to 262 (22 residues), see Phobius details amino acids 287 to 308 (22 residues), see Phobius details amino acids 335 to 354 (20 residues), see Phobius details amino acids 360 to 380 (21 residues), see Phobius details amino acids 401 to 423 (23 residues), see Phobius details amino acids 429 to 448 (20 residues), see Phobius details TIGR01773: GABA permease" amino acids 1 to 450 (450 residues), 747.9 bits, see alignment E=1.9e-229 PF00324: AA_permease" amino acids 18 to 430 (413 residues), 423.7 bits, see alignment E=9.1e-131 PF13520: AA_permease_2" amino acids 18 to 419 (402 residues), 128.7 bits, see alignment E=2.9e-41

Best Hits

Swiss-Prot: 71% identical to BAUD_PSEAE: Probable GABA permease (bauD) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K03293, amino acid transporter, AAT family (inferred from 98% identity to pfs:PFLU0315)

MetaCyc: 69% identical to 4-aminobutanoate:H+ symporter (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-384; TRANS-RXN-57

Predicted SEED Role

"transport permease protein of gamma-aminobutyrate"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7UEJ2 at UniProt or InterPro

Protein Sequence (463 amino acids)

>PS417_01505 gamma-aminobutyrate transporter (Pseudomonas simiae WCS417)
MSSTQSSNDLEQGLKPRHVTMLSIAGVIGAGLFVGSGHAIAAAGPAVLLAYAAAGTLVVL
VMRMLAEMAVASPDTGSFSTYADRAIGHWAGFTIGWLYWWFWVLVIPLEANAAATILHAW
FPDIAIWVFTLVITLLLTATNLFSVKNYGEFEFWFALIKVVAIVGFVILGLAAIFGFLPT
SQVSGVSHLFDTQGFMPNGMGAVLAAILTTMFSFMGTEIVTIAAAESKNPGQQITKATNS
VIWRIGLFYLLSIFIVVSLVPWNDPTLAAVGSYQTVLERMGIPNAKLIVDLVVLVAVTSC
LNSALYTASRMLFSLGRRGDAPAVAKRTNKSGTPYWAVLLSTGAAFLAVFANYVAPAAVF
EFLLASSGAIALLVYLVIAVSQLRMRQKRTAAGEKIVFKMWLFPGLTYAVMVFIVGTLTI
MLFQEAHRIEIIATGVLSLLVVAAGLFVSSRRKTQRAGAAVLN