Protein Info for GFF2949 in Xanthobacter sp. DMC5

Annotation: 3-dehydroquinate synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF13671: AAA_33
  • amino acids 34 to 148 (115 residues), 30.7 bits, E=1.3e-10
• PF13238: AAA_18
  • amino acids 34 to 146 (113 residues), 41.1 bits, E=8.5e-14
• PF01202: SKI
  • amino acids 40 to 194 (155 residues), 155.3 bits, E=5.4e-49
• PF00465: Fe-ADH
  • amino acids 242 to 359 (118 residues), 46.6 bits, E=1.1e-15
• TIGR01357: 3-dehydroquinate synthase
  • amino acids 243 to 590 (348 residues), 343 bits, E=1e-106
• PF13685: Fe-ADH_2
  • amino acids 247 to 362 (116 residues), 31.6 bits, E=5.3e-11
• PF01761: DHQ_synthase
  • amino acids 299 to 411 (113 residues), 148.9 bits, E=1.7e-47
• PF24621: DHQS_C
  • amino acids 413 to 561 (149 residues), 139 bits, E=4.1e-44

Best Hits

KEGG orthology group: K13829, shikimate kinase / 3-dehydroquinate synthase [EC: 2.7.1.71 4.2.3.4] (inferred from 86% identity to xau:Xaut_1633)

Predicted SEED Role

"3-dehydroquinate synthase (EC 4.2.3.4)" in subsystem Chorismate Synthesis or Common Pathway For Synthesis of Aromatic Compounds (DAHP synthase to chorismate) or Type IV pilus (EC 4.2.3.4)

MetaCyc Pathways

• superpathway of aromatic amino acid biosynthesis (18/18 steps found)
• superpathway of L-tryptophan biosynthesis (13/13 steps found)
• superpathway of L-phenylalanine biosynthesis (10/10 steps found)
• superpathway of L-tyrosine biosynthesis (10/10 steps found)
• chorismate biosynthesis I (7/7 steps found)
• chorismate biosynthesis from 3-dehydroquinate (5/5 steps found)
• 3-dehydroquinate biosynthesis I (2/2 steps found)
• chorismate biosynthesis II (archaea) (8/12 steps found)
• superpathway of chorismate metabolism (41/59 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of phenylpropanoids
• Biosynthesis of plant hormones
• Phenylalanine, tyrosine and tryptophan biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.1.71 or 4.2.3.4

Protein Sequence (596 amino acids)

>GFF2949 3-dehydroquinate synthase (Xanthobacter sp. DMC5)
VHTQKFPEPRTGETETAGSISSPELLRRLGRRSIVLVGMPGAGKSSVGRRLAKRLGLTFV
DADEEIERAACMSIPEIFARHGEAEFREGEKRVVARLLQSGPCVLATGGGAFMNADTRAA
VGRHGVSVWLRADLNTLLRRVKKRTDRPLLAQGDPAQKLAALHAQRADTYALADVTVDSR
DVVHELVVEEVISAVHAHLLAFPEGSTMAPLSSATAISAEAEGLPMGEITRSTVRVDVAG
KPYDIYIGPGLLAEAGTHVTALRKGARVAIVTDENVVAAGHLATVAASLDAAGIPHTAIV
VPPGEKTKGWPGLEQVVEGLIAARIERRDLVLALGGGVVGDLAGFAAAVLRRGVDVVQAP
TTLLSQVDSSVGGKTGINSPQGKNLVGAFHQPVLVLADTAALNTLPVREVKAGYAEVVKY
GLLGDYALFETLERDWPGVIGGGQERITAVAASCMAKAAIVARDEKETGDRALLNLGHTF
GHALEAGAGYSQRLLHGEGVAIGMALAFAFSAKLGLCSGQDVTRVVRHLEAVGLPTKISD
VPGELPNTDGLMTLIAQDKKVSRGALTFILVRGIGEAFIAKDVNPEEVRAFLAEMR