Protein Info for GFF2943 in Variovorax sp. SCN45

Annotation: S-formylglutathione hydrolase (EC 3.1.2.12)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 292 TIGR02821: S-formylglutathione hydrolase" amino acids 8 to 290 (283 residues), 412 bits, see alignment E=6.7e-128 PF00756: Esterase" amino acids 26 to 284 (259 residues), 194.5 bits, see alignment E=2.8e-61 PF00326: Peptidase_S9" amino acids 138 to 273 (136 residues), 24.8 bits, see alignment E=1.4e-09

Best Hits

Swiss-Prot: 52% identical to ESTD_MOUSE: S-formylglutathione hydrolase (Esd) from Mus musculus

KEGG orthology group: K01070, S-formylglutathione hydrolase [EC: 3.1.2.12] (inferred from 90% identity to vpe:Varpa_1872)

Predicted SEED Role

"S-formylglutathione hydrolase (EC 3.1.2.12)" in subsystem Glutathione-dependent pathway of formaldehyde detoxification (EC 3.1.2.12)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.2.12

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (292 amino acids)

>GFF2943 S-formylglutathione hydrolase (EC 3.1.2.12) (Variovorax sp. SCN45)
MTDNTPKTLSEHHAFGGVQSFHEHRSHEIGLPMRFSVYLPPQAANGPVPALLYLAGLTCN
EETFAVKAGAQRMAASLGLALIAPDTSPRGAEVETLPGAKDNWDFGIGAGFYLDALAEPW
AAHWRMESWIVHELLPLVAKHFAVDDHRIGIFGHSMGGHGALTLALRHPGRFKSLSAFAP
ICAPTQCPWGEKAFAGYLGAPGDDRAQWLAHDASALMKSQVAAPYPQGILIDQGLSDKFL
AEQLHPEVFEAACFAAGQPLVLRRHAGYDHGYYFIQSFMADHIAHHAQSLHA