Protein Info for GFF2939 in Variovorax sp. SCN45

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF19298: KshA_C
  • amino acids 63 to 206 (144 residues), 25.5 bits, E=1.4e-09
• PF19112: VanA_C
  • amino acids 101 to 270 (170 residues), 74.7 bits, E=1.1e-24

Best Hits

Swiss-Prot: 50% identical to NDMC_PSEDT: Probable methylxanthine N7-demethylase NdmC (G1E_06898) from Pseudomonas sp. (strain TJI-51)

KEGG orthology group: None (inferred from 84% identity to vpe:Varpa_1876)

MetaCyc: 47% identical to monooxygenase NdmC (Pseudomonas putida CBB5)
RXN-11518 [EC: 1.14.13.128]

Predicted SEED Role

No annotation

MetaCyc Pathways

• caffeine degradation III (bacteria, via demethylation) (2/7 steps found)
• caffeine degradation IV (bacteria, via demethylation and oxidation) (2/10 steps found)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.14.13.128

Protein Sequence (281 amino acids)

>GFF2939 hypothetical protein (Variovorax sp. SCN45)
MPFVSDDPNMLDDWLVIGPAAPAPRTTRLLGETVQLWIDPEGTPQCRLADRPLTVQSRYG
YLWACPSGNPARPLFDFPEYSEPGRRTIDCGGIGVAVSGLRVIENFLDMAHFPFVHADYL
GKVPHTEVAQYQVQVEPATGEIWATDCRFWQPRASAAHDSSGSEVLYKYRVMQPFSAMLY
KSSFRAGELDAIGLFLQPVDDEHVIAHTMLACFDDDSTDAELIAFQHTIFGQDKPILENH
AFKRMPLEGRAETPTRGDTSSVTYRRWLRERGMRFGVRAAA