Protein Info for GFF2933 in Xanthobacter sp. DMC5

Annotation: Glutamine synthetase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 344 PF03951: Gln-synt_N" amino acids 6 to 84 (79 residues), 47.3 bits, see alignment E=1.2e-16 PF00120: Gln-synt_C" amino acids 105 to 330 (226 residues), 59.1 bits, see alignment E=4.2e-20

Best Hits

Swiss-Prot: 88% identical to GLNA2_BRADU: Glutamine synthetase (glnII) from Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110)

KEGG orthology group: K01915, glutamine synthetase [EC: 6.3.1.2] (inferred from 94% identity to xau:Xaut_1141)

MetaCyc: 48% identical to glutamine synthetase (Arabidopsis thaliana col)
Glutamate--ammonia ligase. [EC: 6.3.1.2]

Predicted SEED Role

"Glutamine synthetase type II, eukaryotic (EC 6.3.1.2)" in subsystem Ammonia assimilation or Glutamine, Glutamate, Aspartate and Asparagine Biosynthesis or Glutamine synthetases or Peptidoglycan Biosynthesis (EC 6.3.1.2)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 6.3.1.2

Use Curated BLAST to search for 6.3.1.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (344 amino acids)

>GFF2933 Glutamine synthetase (Xanthobacter sp. DMC5)
MPKFKLEYIWLDGYTPVPNLRGKTQIKEYDVFPSLEELPLWGFDGSSTQQAEGRSSDCVL
KPVAVYPDPARTNGALVMCEVMMPDGVTPHPSNKRATILDDAGAWFGFEQEYFFYKNGRP
LGFPEAGYPAPQGPYYTGVGFKNVGDVARQIVEEHLDLCLAAGINHEGINAEVAKGQWEF
QVFGKGSKKAADEVWMARYLLLRLTEKYGVDIEFHCKPLGDTDWNGSGMHANFSTSYMRE
VGGKEYFEKLMAAFEANLDDHIAVYGPDNHMRLTGKHETAPWNKFSYGVADRGASIRVPH
SFIRNDYKGYLEDRRPNSMGDPYQIASQILKTISSVSTDVSAAA