Protein Info for PS417_01495 in Pseudomonas simiae WCS417

Annotation: amino acid ABC transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details PF00497: SBP_bac_3" amino acids 26 to 246 (221 residues), 132.5 bits, see alignment E=8.5e-43 PF10613: Lig_chan-Glu_bd" amino acids 71 to 119 (49 residues), 37.5 bits, see alignment 2.3e-13

Best Hits

Swiss-Prot: 44% identical to ARTJ_ECOLI: ABC transporter arginine-binding protein 1 (artJ) from Escherichia coli (strain K12)

KEGG orthology group: K02030, polar amino acid transport system substrate-binding protein (inferred from 99% identity to pfs:PFLU0313)

MetaCyc: 44% identical to L-arginine ABC transporter periplasmic binding protein (Escherichia coli K-12 substr. MG1655)
ABC-4-RXN [EC: 7.4.2.1]

Predicted SEED Role

"Lysine-arginine-ornithine-binding periplasmic protein precursor (TC 3.A.1.3.1)" in subsystem Arginine and Ornithine Degradation (TC 3.A.1.3.1)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.4.2.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7TX05 at UniProt or InterPro

Protein Sequence (250 amino acids)

>PS417_01495 amino acid ABC transporter (Pseudomonas simiae WCS417)
MQNYKKFLLAAAVSMAFSATAMAETLKMGIEAAYPPFNNKDASGNVVGFDKDIGDALCAK
MKVEKCEVYVSDWDGIIPALNAKKFDFLVSSLSITEERKAAVDFTDPYYSNKLQFIAPKA
TADFKTDAAYLKGKVIGAQRATLAGTYLEDKLPDTEAKLYDTQENAYLDLTSGRLDGILA
DKYVQYEWLKSKDGSAYEFKGDPVVESDKIGIAVRKGDPLRERLNKALAEIKADGTYKKI
NDKYFPFSIE