Protein Info for GFF2924 in Pseudomonas sp. DMC3

Annotation: HTH-type transcriptional regulator KdgR

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 342 PF00356: LacI" amino acids 13 to 59 (47 residues), 50.5 bits, see alignment 2.1e-17 PF00532: Peripla_BP_1" amino acids 72 to 322 (251 residues), 78.6 bits, see alignment E=8.6e-26 PF13377: Peripla_BP_3" amino acids 179 to 336 (158 residues), 69.3 bits, see alignment E=6.9e-23

Best Hits

Swiss-Prot: 38% identical to KDGR_BACSU: HTH-type transcriptional regulator KdgR (kdgR) from Bacillus subtilis (strain 168)

KEGG orthology group: K02525, LacI family transcriptional regulator, kdg operon repressor (inferred from 88% identity to pfo:Pfl01_2900)

Predicted SEED Role

"2-ketogluconate utilization repressor PtxS" in subsystem 2-Ketogluconate Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (342 amino acids)

>GFF2924 HTH-type transcriptional regulator KdgR (Pseudomonas sp. DMC3)
VNDFSAAQRSRVTMLDVAEHAGVSKASVSRFIGDDRALLSDAIARRIEQAIDELGYRPNQ
MARGLKRGRTRLIGMLVADIRNPYSIAVMHGVETACRAHGYSLVVCNTDRDDEQERQHLA
LLRSYNIEGLIVNTLGHHRDELHELRREMPLVLVDRKVDGLDSDMVGLNNPQAVEMALAH
LEQRGYRDLLLVTEPYDGTSSRIERVSSFQAQIAQHSTLTGAVLETGDDLNAQLQSFLNT
PGDGPKALFCANGVAALAATHALRALGVRLFEDVGLIALDDLDWYPLVGSGITALAQPTQ
EIGARAFECLLKRLRGDDEVARMVDFAPVLIERGSTRGIDGV