Protein Info for GFF2922 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: putative c'cytochrome

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 149 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details PF01322: Cytochrom_C_2" amino acids 29 to 148 (120 residues), 136 bits, see alignment E=6.7e-44

Best Hits

Swiss-Prot: 55% identical to CYCP_RUBGE: Cytochrome c' from Rubrivivax gelatinosus

KEGG orthology group: None (inferred from 66% identity to pol:Bpro_0269)

Predicted SEED Role

"putative c'cytochrome"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (149 amino acids)

>GFF2922 putative c'cytochrome (Hydrogenophaga sp. GW460-11-11-14-LB1)
MKIAASLALALAFGSLSVPAFAQFQKPEDAVKYRKGALTVMANHFSRIGAMANGRAPFDA
KVAAESAAIVETMSKLPWEGFVAGTDKGDTAALPAIWTEQAKFKEGSDKLQVATAQLAAA
AKTGNLDSVKTAFGATAQTCKACHDAFRK