Protein Info for GFF2920 in Variovorax sp. SCN45

Annotation: TRAP-type C4-dicarboxylate transport system, large permease component

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details transmembrane" amino acids 43 to 66 (24 residues), see Phobius details amino acids 92 to 108 (17 residues), see Phobius details amino acids 132 to 148 (17 residues), see Phobius details amino acids 156 to 174 (19 residues), see Phobius details amino acids 183 to 203 (21 residues), see Phobius details amino acids 232 to 254 (23 residues), see Phobius details amino acids 260 to 279 (20 residues), see Phobius details amino acids 291 to 312 (22 residues), see Phobius details amino acids 331 to 358 (28 residues), see Phobius details amino acids 362 to 404 (43 residues), see Phobius details amino acids 417 to 440 (24 residues), see Phobius details PF06808: DctM" amino acids 9 to 436 (428 residues), 350.7 bits, see alignment E=1.1e-108 TIGR00786: TRAP transporter, DctM subunit" amino acids 17 to 441 (425 residues), 369.6 bits, see alignment E=8.8e-115 PF03606: DcuC" amino acids 116 to 432 (317 residues), 23.9 bits, see alignment E=1.5e-09

Best Hits

KEGG orthology group: None (inferred from 75% identity to bxe:Bxe_B1796)

Predicted SEED Role

"TRAP-type C4-dicarboxylate transport system, large permease component"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (450 amino acids)

>GFF2920 TRAP-type C4-dicarboxylate transport system, large permease component (Variovorax sp. SCN45)
MALTVLSLSFVLFLLLGMPVAFAIGLSCLATFAYEGLPFETAIQMMVSGMNVFSFLAIPF
FIFSGELMLHGGIADKIVAFARSLVGHWKGGLGLANVVASTLFGGVSGSPVADTSAMGGV
MIPIMKREGYSAAYAVNVTTHASLSGALMPTSHNMIIYAFAAQAAVGTIDGHIIKGVSIG
DLMFAGLIPVFWIMVCMLVAAYWQAAKHGYPKRTDGSTMLERFPGWGMVGKTFLAAIPGL
MVIVIILVCVMQGVATATEAAAIAVTYSLLLTVVAYRTMTREKLFKSLAKASKTTGVILL
LIGVSNMLRYQMAYLEIPDAIETVLLAATTSPWLMLLYINIIQIFLGIFLDMAAHILITT
PLFLPLAIQMGVGPVQFGMMLLLNCALGLVHPPVGTVQFIGCAIGKISIGEATKTAWPYY
LAIFIAITLVTYVPAFSTWLPTMLTGHKVL