Protein Info for GFF292 in Variovorax sp. SCN45

Annotation: Tol-Pal system beta propeller repeat protein TolB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 408 TIGR02800: Tol-Pal system beta propeller repeat protein TolB" amino acids 4 to 403 (400 residues), 488.5 bits, see alignment E=8.4e-151 PF04052: TolB_N" amino acids 9 to 108 (100 residues), 102.4 bits, see alignment E=2.8e-33 PF07676: PD40" amino acids 172 to 204 (33 residues), 22.5 bits, see alignment (E = 1.8e-08) amino acids 213 to 247 (35 residues), 28.7 bits, see alignment 2e-10 amino acids 256 to 291 (36 residues), 51 bits, see alignment 2e-17 amino acids 301 to 334 (34 residues), 24 bits, see alignment 6.1e-09 amino acids 347 to 370 (24 residues), 12.5 bits, see alignment (E = 2.4e-05) PF00930: DPPIV_N" amino acids 266 to 366 (101 residues), 22.7 bits, see alignment E=7.9e-09

Best Hits

Swiss-Prot: 80% identical to TOLB_RHOFT: Tol-Pal system protein TolB (tolB) from Rhodoferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118)

KEGG orthology group: K03641, TolB protein (inferred from 96% identity to vpe:Varpa_2717)

Predicted SEED Role

"tolB protein precursor, periplasmic protein involved in the tonb-independent uptake of group A colicins" in subsystem Ton and Tol transport systems

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (408 amino acids)

>GFF292 Tol-Pal system beta propeller repeat protein TolB (Variovorax sp. SCN45)
MLPALAQFRVEVSGVGLTQLPIALVPFKGQESSPQKISDIVQADLERSGQFRGVDASGQA
LDEASRPDLSLWRQRTADSLVVGSVSRLADGRFDVRFRLWDVVKGQDLGGQSYTVPQGDL
RLASHRIADYVYEKLTGEKGIFSTRIAYVTKAGSRYSLWVADADGENAQAALASPEPIIS
PCWSSNGQQLAYVSFESRKPVVYVHNVASGQRRLLANFKGSNSAPAWAPDGNSLAVTLSR
DGGSQLFTIPASGGEPRRLTQSSSIDTEPAFSADGSTIYFVSDRGGAPQIYKMSASGGNP
TRVTFSGTYNISPAVSGDGRWLAYISRVGGAFKLHVMELASGNVSAITDTSADESPSFAP
NSKLIVYATQLQGREALMTTTLDGKIKARLAGQAGDIREPDWGPFQKQ