Protein Info for GFF292 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: FIG001943: hypothetical protein YajQ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 163 PF04461: YajQ" amino acids 2 to 162 (161 residues), 212.5 bits, see alignment E=2e-67

Best Hits

Swiss-Prot: 76% identical to Y1080_POLNA: UPF0234 protein Pnap_1080 (Pnap_1080) from Polaromonas naphthalenivorans (strain CJ2)

KEGG orthology group: K09767, hypothetical protein (inferred from 76% identity to pna:Pnap_1080)

Predicted SEED Role

"FIG001943: hypothetical protein YajQ"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (163 amino acids)

>GFF292 FIG001943: hypothetical protein YajQ (Hydrogenophaga sp. GW460-11-11-14-LB1)
MPSFDTVLEADFVEVKNAVDQVTREIGTRFDFKGTGAAIELKEKEKEIILHGDADFQLQQ
IDDVLRGKLTKRGVDARFLDVGKVEKAGGDKVKQVVKVRNGISTEDGKKIQQVIKGSKLK
VQGAIQGDAVRVTGAKRDDLQAAMALIRSELKDLPLSFNNFRD