Protein Info for GFF2916 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: LSU ribosomal protein L16p (L10e)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01164: ribosomal protein uL16
  • amino acids 2 to 126 (125 residues), 188.4 bits, E=2.4e-60
• PF00252: Ribosomal_L16
  • amino acids 4 to 132 (129 residues), 170.6 bits, E=7.8e-55

Best Hits

Swiss-Prot: 89% identical to RL16_POLSJ: 50S ribosomal protein L16 (rplP) from Polaromonas sp. (strain JS666 / ATCC BAA-500)

KEGG orthology group: K02878, large subunit ribosomal protein L16 (inferred from 90% identity to ctt:CtCNB1_0313)

MetaCyc: 74% identical to 50S ribosomal subunit protein L16 (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"LSU ribosomal protein L16p (L10e)" in subsystem Ribosome LSU bacterial

Protein Sequence (138 amino acids)

>GFF2916 LSU ribosomal protein L16p (L10e) (Hydrogenophaga sp. GW460-11-11-14-LB1)
MLQPARRKFRKEQKGRNTGVATSGATVAFGDFGLKSTDRGRLTARQIEAARRAISRHVKR
GGRIWIRVFPDKPISQKPAEVRMGNGKGSVEYYVAEIQPGKVLYEIVGVPEQLAREAFTL
AAAKLPLRTTFVTRMLGQ