Protein Info for GFF2914 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: LSU ribosomal protein L22p (L17e)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 109 TIGR01044: ribosomal protein uL22" amino acids 7 to 107 (101 residues), 143.7 bits, see alignment E=1e-46 PF00237: Ribosomal_L22" amino acids 8 to 107 (100 residues), 127.2 bits, see alignment E=1.4e-41

Best Hits

Swiss-Prot: 93% identical to RL22_ACIAC: 50S ribosomal protein L22 (rplV) from Acidovorax citrulli (strain AAC00-1)

KEGG orthology group: None (inferred from 92% identity to xtr:100486714)

MetaCyc: 64% identical to 50S ribosomal subunit protein L22 (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"LSU ribosomal protein L22p (L17e)" in subsystem Ribosome LSU bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (109 amino acids)

>GFF2914 LSU ribosomal protein L22p (L17e) (Hydrogenophaga sp. GW460-11-11-14-LB1)
METRSIVRGVRLSVDKGRLVADLIRGKKVDQALNILAFTQKKAAGIVKKALESAIANAEH
NDGADIDELKVKTIYVEQGTTLKRFSARAKGRGNRISKPTCHIYVTVGN