Protein Info for PS417_14895 in Pseudomonas simiae WCS417

Annotation: beta-lactamase/D-alanine carboxypeptidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 384 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details PF00144: Beta-lactamase" amino acids 34 to 381 (348 residues), 271.3 bits, see alignment E=6.1e-85

Best Hits

Swiss-Prot: 78% identical to AMPC_PSEFL: Beta-lactamase (ampC) from Pseudomonas fluorescens

KEGG orthology group: K01467, beta-lactamase [EC: 3.5.2.6] (inferred from 72% identity to pfs:PFLU3467)

MetaCyc: 44% identical to beta-lactamase (Escherichia coli K-12 substr. MG1655)
Beta-lactamase. [EC: 3.5.2.6]

Predicted SEED Role

"Beta-lactamase (EC 3.5.2.6)" in subsystem Beta-lactamase or Tn552 (EC 3.5.2.6)

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.2.6

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7UIL9 at UniProt or InterPro

Protein Sequence (384 amino acids)

>PS417_14895 beta-lactamase/D-alanine carboxypeptidase (Pseudomonas simiae WCS417)
MPQLPLSGVRNLGAAALFLAAGHCLAADDLRAVVDASIKPLMQQQSIPGLVVGIVKDGKT
QYFNYGVASKDARQPVSENTLFEIGSVSKTFTATLAGYAVASGKLTLSDPASQYLPALRN
SKFDHISVLNLGTYTPGGLPLQFPREADNNQHMISYFQQWKPDFAPGTQRLYSNPSLGLF
GYLAAQSLKQPFDQVMEKTLLPKLGLKHTFVKVPDSQMNLYAQGYGKDGKPVRVGPGAMD
SEAYGIKTSAADLLHYVSVNINPASLEKPLQQAIATTHTGYYNVNGMTQGLGWEMYPYPI
KLDALLDGNSTKMAMEPNPVNWLTPPQAPHADTLLNKTGSTSGFGTYVAYVPSKAMGVVI
LANKNYPIAERVKVAHAILSAMDH