Protein Info for GFF2910 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: LSU ribosomal protein L4p (L1e)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 206 TIGR03953: 50S ribosomal protein uL4" amino acids 16 to 203 (188 residues), 231 bits, see alignment E=3.6e-73 PF00573: Ribosomal_L4" amino acids 16 to 203 (188 residues), 228.3 bits, see alignment E=3.2e-72

Best Hits

Swiss-Prot: 88% identical to RL4_POLSJ: 50S ribosomal protein L4 (rplD) from Polaromonas sp. (strain JS666 / ATCC BAA-500)

KEGG orthology group: K02926, large subunit ribosomal protein L4 (inferred from 88% identity to pol:Bpro_0257)

MetaCyc: 55% identical to 50S ribosomal subunit protein L4 (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"LSU ribosomal protein L4p (L1e)" in subsystem Ribosome LSU bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (206 amino acids)

>GFF2910 LSU ribosomal protein L4p (L1e) (Hydrogenophaga sp. GW460-11-11-14-LB1)
MQVELLNDQGQASSNVDVPETVFGRDYNEALIHQLVVAYQANARQGTRAQKDRQMVKHST
KKPFKQKGTGRARAGMTSSPLWRGGGRIFPNSPDENFTQKLNKKMYRAGMASIFSQLVRE
GRLAVVDSIKVDSPKTKQLADKFKAMNLQSVLVIAEEVDENLYLASRNLPNVLVVEPRYA
DPLSLVHYKKVIVTKAAIDQLKEMFA