Protein Info for GFF2909 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: LSU ribosomal protein L3p (L3e)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 253 TIGR03625: 50S ribosomal protein uL3" amino acids 37 to 241 (205 residues), 274 bits, see alignment E=4.2e-86 PF00297: Ribosomal_L3" amino acids 97 to 219 (123 residues), 56.1 bits, see alignment E=1.6e-19

Best Hits

Swiss-Prot: 84% identical to RL3_ACIET: 50S ribosomal protein L3 (rplC) from Acidovorax ebreus (strain TPSY)

KEGG orthology group: K02906, large subunit ribosomal protein L3 (inferred from 84% identity to ajs:Ajs_0278)

Predicted SEED Role

"LSU ribosomal protein L3p (L3e)" in subsystem Ribosome LSU bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (253 amino acids)

>GFF2909 LSU ribosomal protein L3p (L3e) (Hydrogenophaga sp. GW460-11-11-14-LB1)
MILDQAVLRVELQFRTISPGQLKSGTEKTMSLSNSLGLLGRKVGMMRLFTDDGDAVPVTV
VDVSNNRVTQVKTLANDGYDALQVTFGARRASRVTKPEAGHLAKAGVEAGEIIQEFRVAS
DVAAQYAPGAVVAANAIFAAGQKVDVQGTSIGKGFAGTIKRHNFSSQRASHGNSRSHNVP
GSISMAQDPGRVFPGKKMTGHMGDVTKTIQNLDIVRVDEARQLIMIRGAVPGSNGGFVTV
RPAIKAKVAKGAN