Protein Info for GFF2902 in Xanthobacter sp. DMC5

Annotation: C4-dicarboxylate transport sensor protein DctB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 625 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details transmembrane" amino acids 300 to 318 (19 residues), see Phobius details PF02743: dCache_1" amino acids 48 to 222 (175 residues), 52 bits, see alignment E=1.1e-17 PF00512: HisKA" amino acids 390 to 456 (67 residues), 36.8 bits, see alignment E=5e-13 PF02518: HATPase_c" amino acids 501 to 606 (106 residues), 69.4 bits, see alignment E=5.3e-23

Best Hits

KEGG orthology group: K10125, two-component system, NtrC family, C4-dicarboxylate transport sensor histidine kinase DctB [EC: 2.7.13.3] (inferred from 72% identity to xau:Xaut_4049)

Predicted SEED Role

"FIG00801173: hypothetical protein"

Isozymes

Compare fitness of predicted isozymes for: 2.7.13.3

Use Curated BLAST to search for 2.7.13.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (625 amino acids)

>GFF2902 C4-dicarboxylate transport sensor protein DctB (Xanthobacter sp. DMC5)
MRSNRITALGAVLSALLAAAAVFAVLEAGEMAEARVGERLASDARHRAEIYAQSLEGAIE
RFGYLPAAAALDENVKRLLATPSDGEQVARVNAYLETLNRAAGGTVLYLLAPGGMTIAAS
NWNTPETYVGTDFSYRPYYTEAMAGGTGRFYAVGTLTGVPGYFISAPVMVDGKVAGVVAT
KVNLDPLEAVWHEAADTVLVADEHGIVFLASDPKFKFRALRPIDATAAAEMARTRQYGHK
SYPLLRMGRGEDEGGLKVLSGSDISPAGLVLRDEKDLPTYDWQLQLFTDAAPVVLAGRSA
RIGMTLALVILGLVGLYWRQHLRRARETLAAQAALAAAHRELEGKVAERTADLSAANTRL
AAEIEERRRAESELRAAQDELVQAAKMATLGQMAAGVTHELNQPLTALRALADNTAKLLQ
HGREEDAEANLARIAALVDRLGKITGQLRAFARRTSSEKGPVDAAAVLAESLAILAPRLR
ASGARVVSALDPDATQVMFEPIRLSQVLVNLVGNALDAVKGRPEAAVRIVSHREGGRIVL
TVEDNGPGLLDGAAERIFDPFFTTKPAGEGLGLGLPISLAIARDFGATLTARTRAEGGTA
FDLAMDAAEAEAHLTLPAEPLRHVS