Protein Info for GFF2902 in Sphingobium sp. HT1-2

Annotation: HtrA protease/chaperone protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 502 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details TIGR02037: peptidase Do" amino acids 47 to 491 (445 residues), 447.2 bits, see alignment E=3.3e-138 PF00089: Trypsin" amino acids 97 to 265 (169 residues), 78.8 bits, see alignment E=1.4e-25 PF13365: Trypsin_2" amino acids 100 to 239 (140 residues), 128.7 bits, see alignment E=7.4e-41 PF00595: PDZ" amino acids 276 to 355 (80 residues), 31.6 bits, see alignment E=4.5e-11 PF13180: PDZ_2" amino acids 278 to 367 (90 residues), 42.7 bits, see alignment E=1.4e-14 PF17820: PDZ_6" amino acids 305 to 358 (54 residues), 34.1 bits, see alignment 4.6e-12

Best Hits

KEGG orthology group: None (inferred from 89% identity to sch:Sphch_3129)

Predicted SEED Role

"HtrA protease/chaperone protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (502 amino acids)

>GFF2902 HtrA protease/chaperone protein (Sphingobium sp. HT1-2)
VRYAYAITGALLLGGTAIAVTTSSNVGAQTAQNEGLQAAAPAGAPASLADMVEKLQPAVV
NISTKQRVTVQNPFAGTPFGDLFGQGGGGKPQTRQAQSLGSGFLISADGYIVTNNHVVSA
GAEGASVDSITVTMTNKEEYPAKLVGRDPATDLAVLKIDAKKPLPFVKFGDSTKARVGDW
VVAIGNPFALSGTVTAGIISAVHRGTGGTYDKFIQTDASINQGNSGGPMFDMRGNVIGIN
SQILSPSGGNVGIGFAIPSEQAAPIVDTLRQGQSIKRGYLGVQISPLGEDMADSLGLAKN
RGEFVQGVEPGKGAEKAGIKAGDVIVSVAGQEVTPDQNLSSIVANSKIGSSVPIVLLRNG
QRMTLNAVVGERPSEDELNNFAQQQDDDFSQQGDQGSDTQAAQKSLGISAIPLTPSITRQ
LGVAGDTRGIVITAVDGSTDAGAKGLRRGDVILSANNRPVLTQADLDAQVKAVSAQGRNA
ILLQVLRRGQAPLFLPIRLRDK