Protein Info for GFF2898 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Transcriptional regulator, MarR family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 161 PF12802: MarR_2" amino acids 42 to 101 (60 residues), 36.6 bits, see alignment E=8.5e-13 PF01047: MarR" amino acids 44 to 101 (58 residues), 37.8 bits, see alignment E=2.9e-13 PF13463: HTH_27" amino acids 63 to 110 (48 residues), 22.3 bits, see alignment E=2.5e-08

Best Hits

KEGG orthology group: None (inferred from 76% identity to pol:Bpro_0592)

Predicted SEED Role

"Transcriptional regulator, MarR family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (161 amino acids)

>GFF2898 Transcriptional regulator, MarR family (Hydrogenophaga sp. GW460-11-11-14-LB1)
MLDLEARAHSEHAHELRLWLRLLTCSQLIEKRVRAGLREQFDTTLPRFDLMAQLERHPDG
LKMKELSHRLMVTGGNVTGITDQLVNEGLVERMGVDGDRRAFRVRLTPHGRASFAEMAQQ
HESWIVEAFEGLSPRDLDSLHKLLGKVKQHQLELNQRIDEE