Protein Info for GFF2896 in Sphingobium sp. HT1-2

Annotation: Succinyl-CoA synthetase, alpha subunit-related enzymes

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 144 PF02629: CoA_binding" amino acids 15 to 102 (88 residues), 27.7 bits, see alignment E=3.9e-10 PF13380: CoA_binding_2" amino acids 17 to 133 (117 residues), 134.6 bits, see alignment E=2.2e-43

Best Hits

Swiss-Prot: 61% identical to YCCU_ECOLI: Uncharacterized protein YccU (yccU) from Escherichia coli (strain K12)

KEGG orthology group: K06929, (no description) (inferred from 88% identity to sjp:SJA_C1-10270)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (144 amino acids)

>GFF2896 Succinyl-CoA synthetase, alpha subunit-related enzymes (Sphingobium sp. HT1-2)
MPLTAAQDIADLLNETRTIALVGISDRPDRPSYSVMKTLQDHGYRVLPVNPQIAGEHVHG
EFVWDRLSDIGVRIDMVDIFRRSEAAGEVVDQAIAAGAKAVWMQLGVIDADAAARAEAAG
LKVVMDYCPAIEIRRLGLAPIAAD