Protein Info for GFF2895 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Acyl-coenzyme A synthetases/AMP-(fatty) acid ligases

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR02262: benzoate-CoA ligase family
  • amino acids 41 to 545 (505 residues), 376.7 bits, E=9.6e-117
• PF00501: AMP-binding
  • amino acids 50 to 405 (356 residues), 242.3 bits, E=8.1e-76
• PF13193: AMP-binding_C
  • amino acids 459 to 537 (79 residues), 90.2 bits, E=1.3e-29

Best Hits

KEGG orthology group: K08295, 2-aminobenzoate-CoA ligase [EC: 6.2.1.32] (inferred from 69% identity to vpe:Varpa_5752)

Predicted SEED Role

"Acyl-coenzyme A synthetases/AMP-(fatty) acid ligases"

MetaCyc Pathways

• anthranilate degradation II (aerobic) (2/2 steps found)
• anthranilate degradation III (anaerobic) (1/2 steps found)
• 4-hydroxy-2(1H)-quinolone biosynthesis (3/5 steps found)
• aurachin RE biosynthesis (1/5 steps found)
• superpathway of quinolone and alkylquinolone biosynthesis (3/10 steps found)
• 2-heptyl-3-hydroxy-4(1H)-quinolone biosynthesis (1/8 steps found)
• aurachin A, B, C and D biosynthesis (3/11 steps found)
• anaerobic aromatic compound degradation (Thauera aromatica) (6/27 steps found)

KEGG Metabolic Maps

• Acridone alkaloid biosynthesis
• Benzoate degradation via CoA ligation
• Biosynthesis of alkaloids derived from shikimate pathway
• Carbazole degradation

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.2.1.32

Protein Sequence (555 amino acids)

>GFF2895 Acyl-coenzyme A synthetases/AMP-(fatty) acid ligases (Hydrogenophaga sp. GW460-11-11-14-LB1)
MNKIAIPSAQPDHFVHDHLPPPGQWPELRFDRPELLLPAQVNAVQALFQRAVEAGHGDRP
LFRSDERTLTYAQAQIEVNRIANALTVELGLVPGNRVLLRGGNSVAMALAWLGTVQAGLI
AVATMPLLRAKELGAILTKAQPSVALCDVKLQDELKAALAADPAMAGMKLLTFNTAEGEA
PHALEALARRQCEHGTPCPTAATDIALLAFTSGTTGTPKAAVHTHRDVLAACETWPRHVL
RATPDDIVMGSPPLAFTFGLGGLLVFPMWAGASVYFPSIPYTPEAMVQLIGRVGATICYT
APTFYRQMAAFARQHGIGRLRISVSAGEGLPDATRQLWKEATGLEMLDGIGATEMFHIFI
SSPPEAVRRGAIGRVVPGYEARVVDDEGRPLPVGEVGKLAVIGPTGCKYLDEPRQTQYVR
DGWNFPGDAFRQDADGYFFYQARTDDMIITAGYNVAGPEVEAALLQHPAVAECGVVGKAD
EERGQIVLAYVVLKPGEAADAAQVKALQEHVKQNMAPYKYPREVVFVSQLPRTETGKLQR
FALRQQAQQHRESTP