Protein Info for GFF2895 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868
Annotation: Peptidyl-prolyl cis-trans isomerase PpiC (EC 5.2.1.8)
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 100% identical to PPIC_SALTI: Peptidyl-prolyl cis-trans isomerase C (ppiC) from Salmonella typhi
KEGG orthology group: K03769, peptidyl-prolyl cis-trans isomerase C [EC: 5.2.1.8] (inferred from 99% identity to esa:ESA_03780)MetaCyc: 95% identical to peptidyl-prolyl cis-trans isomerase C (Escherichia coli K-12 substr. MG1655)
Peptidylprolyl isomerase. [EC: 5.2.1.8]
Predicted SEED Role
"Peptidyl-prolyl cis-trans isomerase PpiC (EC 5.2.1.8)" (EC 5.2.1.8)
Isozymes
Compare fitness of predicted isozymes for: 5.2.1.8
Use Curated BLAST to search for 5.2.1.8
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
Find the best match in UniProt
Protein Sequence (93 amino acids)
>GFF2895 Peptidyl-prolyl cis-trans isomerase PpiC (EC 5.2.1.8) (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868) MAKMAAALHILVKEEKLALDLLEQIKNGGDFEKLAKKHSICPSGKKGGHLGEFRQGQMVP AFDKVVFSCPVLEPTGPLHTQFGYHIIKVLYRK