Protein Info for GFF2894 in Pseudomonas sp. DMC3

Annotation: HTH-type transcriptional activator RhaS

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 301 PF00165: HTH_AraC" amino acids 200 to 232 (33 residues), 30.4 bits, see alignment 3.4e-11 amino acids 252 to 289 (38 residues), 33.7 bits, see alignment 3e-12 PF12833: HTH_18" amino acids 212 to 289 (78 residues), 85.4 bits, see alignment E=2.7e-28

Best Hits

KEGG orthology group: None (inferred from 95% identity to pfo:Pfl01_2641)

Predicted SEED Role

"Transcriptional regulator of various polyols utilization, AraC family" in subsystem Ribitol, Xylitol, Arabitol, Mannitol and Sorbitol utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (301 amino acids)

>GFF2894 HTH-type transcriptional activator RhaS (Pseudomonas sp. DMC3)
MTRTARVTDPSYELMDDHNGLSIIYRQHGFPCPLVRWHFHKEYELHLIVASSGKVFIGDY
IGNFYPETLFLTGPNLPHNWISQIAEDEVVEKRDMLVNFTDELFESGHQVFAELKSLAPL
LERAQYGIEFRCKRTIRQAMTLMQRIADSTGITRLGHFFILMELLAASDDFQLLSGATTP
QLADEHNIDRTNRAVDYIFSHYARDISLEEVAVHLGMTPTYFSRVFKQATGRNFIEFVNR
LRISKSCELLADGDKPVTEVCFESGFNNISNFNRRFQQLKGMTPSHYRRLAVQRLTEQNH
L