Protein Info for GFF2892 in Variovorax sp. SCN45

Annotation: ABC transporter, substrate-binding protein (cluster 4, leucine/isoleucine/valine/benzoate)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 390 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details PF13458: Peripla_BP_6" amino acids 29 to 368 (340 residues), 217.2 bits, see alignment E=7.8e-68 PF13433: Peripla_BP_5" amino acids 30 to 372 (343 residues), 93.7 bits, see alignment E=1.9e-30 PF01094: ANF_receptor" amino acids 59 to 352 (294 residues), 51.1 bits, see alignment E=1.7e-17

Best Hits

Swiss-Prot: 43% identical to LIVB6_BRUAB: Leu/Ile/Val-binding protein homolog 6 (BruAb2_0578) from Brucella abortus biovar 1 (strain 9-941)

KEGG orthology group: K01999, branched-chain amino acid transport system substrate-binding protein (inferred from 93% identity to vap:Vapar_1747)

Predicted SEED Role

"Benzoate transport, extracellular ligand-binding receptor" in subsystem Benzoate transport and degradation cluster

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (390 amino acids)

>GFF2892 ABC transporter, substrate-binding protein (cluster 4, leucine/isoleucine/valine/benzoate) (Variovorax sp. SCN45)
MQRRHLIQTAALSALALSMSLASAQDNKFKIGLILPMTGQSASTGRQIEAAARLYMAQNG
DTVAGKKVELIVKDDTGLPDVTKRLAQELVVNDKVNVLAGFGLTPLALAVAPIATQSKTP
EVVMAAATSSITEASPYIIRSSFTLPQVSVAMGDWAPKNGVKTVVTLVADYGPGNDAEKF
FSERFVLNGGKVIEKLRVPLRNPDFAPFLQKVRDAKPDALFVFVPSGAGAAVMKQFLERG
MDKAGIKMIATGDVTDDDQLNDMGDGALGVVTSHHYSAAHPSAMNKKFVEAFEKANPKMR
PNFMAVGGYDGMRVIYEALKTTKGQGGGEALLAAMKGQVFESPRGQVLIDAQTRDIVQDV
YLRKVEKKDGQLYNVEFDVIKSVKDPGKAK