Protein Info for GFF2890 in Variovorax sp. SCN45

Annotation: ABC transporter, permease protein 2 (cluster 4, leucine/isoleucine/valine/benzoate)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 332 transmembrane" amino acids 20 to 38 (19 residues), see Phobius details amino acids 43 to 66 (24 residues), see Phobius details amino acids 70 to 90 (21 residues), see Phobius details amino acids 96 to 117 (22 residues), see Phobius details amino acids 123 to 140 (18 residues), see Phobius details amino acids 172 to 189 (18 residues), see Phobius details amino acids 210 to 252 (43 residues), see Phobius details amino acids 259 to 283 (25 residues), see Phobius details amino acids 293 to 311 (19 residues), see Phobius details PF02653: BPD_transp_2" amino acids 46 to 307 (262 residues), 117.8 bits, see alignment E=2.5e-38

Best Hits

KEGG orthology group: K01998, branched-chain amino acid transport system permease protein (inferred from 92% identity to vpe:Varpa_1922)

Predicted SEED Role

"Branched-chain amino acid transport system permease protein LivM (TC 3.A.1.4.1)" in subsystem ABC transporter branched-chain amino acid (TC 3.A.1.4.1) (TC 3.A.1.4.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (332 amino acids)

>GFF2890 ABC transporter, permease protein 2 (cluster 4, leucine/isoleucine/valine/benzoate) (Variovorax sp. SCN45)
MSAPSSAADFQSALLRKARWHPLEFVVWAAAFALPLVMPSHSLLVNEIAIVALFAMSLDL
ILGYTGIVSLGHAAFFGFGAYAAALFAKLVMPDPTVGLAVAVVLSALLGLVASVTILRGS
DLTRLMVTLGTALLLLELANKLDWLTGGADGLQGVVMGPVLGMFDFDLYGRTAAWYSLAV
MLVLFLLMRRLVHSPFGATLKAIRDNRLRAMAIGIPVVPRLVTVYTIAAGVAGAAGALLA
QTTGFASLDVLAFDRSADVLLMLVIGGVGWLYGGVAGAIVFKLLQTWLSAVTPQYWMFWI
GLILVLLVLVGRDRLLKPWTWFGAGKKKGGAA