Protein Info for GFF2890 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Transcription termination factor Rho

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 419 TIGR00767: transcription termination factor Rho" amino acids 2 to 417 (416 residues), 737.3 bits, see alignment E=2.3e-226 PF07498: Rho_N" amino acids 5 to 47 (43 residues), 58.5 bits, see alignment 7.8e-20 PF07497: Rho_RNA_bind" amino acids 52 to 125 (74 residues), 117.2 bits, see alignment E=3.3e-38 PF00006: ATP-synt_ab" amino acids 160 to 363 (204 residues), 93.9 bits, see alignment E=1.7e-30

Best Hits

Swiss-Prot: 100% identical to RHO_SALTY: Transcription termination factor Rho (rho) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K03628, transcription termination factor Rho (inferred from 100% identity to eco:b3783)

Predicted SEED Role

"Transcription termination factor Rho" in subsystem Transcription factors bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (419 amino acids)

>GFF2890 Transcription termination factor Rho (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MNLTELKNTPVSELITLGESMGLENLARMRKQDIIFAILKQHAKSGEDIFGDGVLEILQD
GFGFLRSADSSYLAGPDDIYVSPSQIRRFNLRTGDTISGKIRPPKEGERYFALLKVNEVN
YDKPENARNKILFENLTPLHANSRLRMERGNGSTEDLTARVLDLASPIGRGQRGLIVAPP
KAGKTMLLQNIAQSIAYNHPDCVLMVLLIDERPEEVTEMQRLVKGEVVASTFDEPASRHV
QVAEMVIEKAKRLVEHKKDVIILLDSITRLARAYNTVVPASGKVLTGGVDANALHRPKRF
FGAARNVEEGGSLTIIATALIDTGSKMDEVIYEEFKGTGNMELHLSRKIAEKRVFPAIDY
NRSGTRKEELLTTQEELQKMWILRKIIHPMGEIDAMEFLINKLAMTKTNDDFFEMMKRS