Protein Info for PS417_14775 in Pseudomonas simiae WCS417

Annotation: major facilitator transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 467 transmembrane" amino acids 19 to 36 (18 residues), see Phobius details amino acids 59 to 78 (20 residues), see Phobius details amino acids 88 to 108 (21 residues), see Phobius details amino acids 114 to 135 (22 residues), see Phobius details amino acids 169 to 191 (23 residues), see Phobius details amino acids 197 to 217 (21 residues), see Phobius details amino acids 267 to 287 (21 residues), see Phobius details amino acids 307 to 329 (23 residues), see Phobius details amino acids 341 to 359 (19 residues), see Phobius details amino acids 364 to 385 (22 residues), see Phobius details amino acids 397 to 422 (26 residues), see Phobius details amino acids 435 to 454 (20 residues), see Phobius details PF07690: MFS_1" amino acids 27 to 414 (388 residues), 175.4 bits, see alignment E=1.6e-55

Best Hits

KEGG orthology group: K08191, MFS transporter, ACS family, hexuronate transporter (inferred from 96% identity to pfs:PFLU3436)

Predicted SEED Role

"Hexuronate transporter" in subsystem Alginate metabolism or D-Galacturonate and D-Glucuronate Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7UCL3 at UniProt or InterPro

Protein Sequence (467 amino acids)

>PS417_14775 major facilitator transporter (Pseudomonas simiae WCS417)
MNLNEPINAHRVGQAVGNYRWTICAMLFFATTVNYLDRQVLSLLAPQLSTQFGWSNTDYA
NIAAVFQFVYAISMLFAGRFVDKIGTKAAYVVAIAIWSTGAIMHAFSVPMGEGIAAISGA
IGLAVIPVSIAGFMLSRAVLAIGEAGNFPIAIKATAEYFPKKERSLATGIFNSGANVGAI
LAPICVPLIAGLWGWEAAFIVIGGLGFVWVVVWIALYQKPEEQKRLSPEELAYIRSDQTV
QPFTPAPAGAPEKKVSWFKLLTYRQTWAFAFGKFMTDGVWWFFLFWLPTYLSAQYGMKGA
DIVMPLAVLYSMTMVGSIGGGWFPSYFMARGDAPYDGRMKAMLVIALFPLVVLLAQPLGY
ISFWVPVLLIGVGASAHQAWSCNIFTTVSDMFPQKTVASVVGIGGMAGGLGGVVMTKIGG
WVFDYYKSVGDIHTGYMIMFAICALAYLVAWSVMKTLVPRHKEITDL