Protein Info for GFF2889 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Rubisco activation protein CbbQ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 266 PF07728: AAA_5" amino acids 34 to 168 (135 residues), 108.1 bits, see alignment E=5.8e-35 PF08406: CbbQ_C" amino acids 181 to 264 (84 residues), 98 bits, see alignment E=4.4e-32

Best Hits

Swiss-Prot: 60% identical to CBBQ_HYDTE: Protein CbbQ (cbbQ) from Hydrogenophilus thermoluteolus

KEGG orthology group: K04748, nitric oxide reductase NorQ protein (inferred from 65% identity to rsq:Rsph17025_4065)

Predicted SEED Role

"Rubisco activation protein CbbQ" in subsystem CO2 uptake, carboxysome

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (266 amino acids)

>GFF2889 Rubisco activation protein CbbQ (Hydrogenophaga sp. GW460-11-11-14-LB1)
VDPLADWRLAQEPFYQPVGQEIAAFEAARAARLPVLLKGPTGCGKTRFVEHMAWRLKLPL
VTVACHEDLTAGDLAGRWLLDAQGTRWMDGPLALAARHGALCYLDELLEARSDTTVLLHP
LADTRRALPLERHGELLPAHPDFQLVVSYNPGYQGLHKGLKPSTRQRFVALAFDYPEPAA
EAAIVAHEGGVDGAMARQLVQLAARTRRLQDQGLEEGASTRMLVHAALLVRAGLPPAAAA
LQAIADPLSDDAELLAALHALVRASF