Protein Info for GFF2889 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Undecaprenyl-phosphate N-acetylglucosaminyl 1-phosphate transferase (EC 2.7.8.-)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 367 transmembrane" amino acids 6 to 24 (19 residues), see Phobius details amino acids 45 to 64 (20 residues), see Phobius details amino acids 70 to 89 (20 residues), see Phobius details amino acids 101 to 125 (25 residues), see Phobius details amino acids 132 to 151 (20 residues), see Phobius details amino acids 161 to 179 (19 residues), see Phobius details amino acids 185 to 206 (22 residues), see Phobius details amino acids 213 to 232 (20 residues), see Phobius details amino acids 244 to 263 (20 residues), see Phobius details amino acids 294 to 314 (21 residues), see Phobius details amino acids 321 to 339 (19 residues), see Phobius details TIGR02380: undecaprenyl-phosphate alpha-N-acetylglucosaminyl 1-phosphatetransferase" amino acids 8 to 351 (344 residues), 553.8 bits, see alignment E=7.7e-171 PF00953: Glycos_transf_4" amino acids 76 to 233 (158 residues), 110.3 bits, see alignment E=5e-36

Best Hits

Swiss-Prot: 100% identical to WECA_SALTY: Undecaprenyl-phosphate alpha-N-acetylglucosaminyl 1-phosphate transferase (wecA) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K02851, undecaprenyl-phosphate alpha-N-acetylglucosaminyltransferase [EC: 2.7.8.-] (inferred from 100% identity to sty:STY3637)

MetaCyc: 87% identical to UDP-N-acetylglucosamine--undecaprenyl-phosphate N-acetylglucosaminephosphotransferase (Escherichia coli K-12 substr. MG1655)
GLCNACPTRANS-RXN [EC: 2.7.8.33]

Predicted SEED Role

"Undecaprenyl-phosphate N-acetylglucosaminyl 1-phosphate transferase (EC 2.7.8.-)" in subsystem Methicillin resistance in Staphylococci or Teichoic and lipoteichoic acids biosynthesis (EC 2.7.8.-)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.8.-

Use Curated BLAST to search for 2.7.8.- or 2.7.8.33

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (367 amino acids)

>GFF2889 Undecaprenyl-phosphate N-acetylglucosaminyl 1-phosphate transferase (EC 2.7.8.-) (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
VKLLTALSELISIFLFTTIFIFLARKVAIKIGLVDKPNFRKRHQGVIPLVGGISVFAGIC
FMFGLSDYYIPHLSLYLICAGVLVFVGAMDDRFDISVKIRAVVQAVIAVVMMVIAKLHLG
SLGYIFGPWELVLGPFGYFLTLFAVWAAINAFNMVDGIDGLLGGLSSVSFAAMGLILWFD
GQTSLAMWCFAMIAAILPYIMLNLGILGRRYKVFMGDAGSTLIGFTVIWLLLETTQGKTH
SISPVTALWIIAIPLMDMVAIMYRRLRKGMSPFSPDRQHIHHLVMRAGFTSRQAFVLITL
AAAILAGVGVTAEYSHFVPEWVMLVLFLLAFFLYGYCIKRAWKVARFIKRVKRRLRRQRE
NRPNLTK