Protein Info for PS417_14770 in Pseudomonas simiae WCS417

Annotation: MarR family transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 306 PF12802: MarR_2" amino acids 35 to 93 (59 residues), 40.9 bits, see alignment E=8.3e-14 PF01047: MarR" amino acids 37 to 94 (58 residues), 38.8 bits, see alignment E=3.1e-13 PF22381: Staph_reg_Sar_Rot" amino acids 37 to 106 (70 residues), 31.8 bits, see alignment E=5.6e-11 PF13463: HTH_27" amino acids 43 to 102 (60 residues), 23.6 bits, see alignment E=2.4e-08 PF13480: Acetyltransf_6" amino acids 158 to 264 (107 residues), 27.7 bits, see alignment E=1.3e-09 PF00583: Acetyltransf_1" amino acids 170 to 282 (113 residues), 66.5 bits, see alignment E=1.2e-21 PF13508: Acetyltransf_7" amino acids 201 to 283 (83 residues), 60.6 bits, see alignment E=6.9e-20 PF13673: Acetyltransf_10" amino acids 201 to 290 (90 residues), 47.1 bits, see alignment E=1.1e-15 PF08445: FR47" amino acids 224 to 288 (65 residues), 25.6 bits, see alignment E=4.5e-09

Best Hits

KEGG orthology group: None (inferred from 89% identity to pfs:PFLU3435)

Predicted SEED Role

"FIG01289214: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7TXW9 at UniProt or InterPro

Protein Sequence (306 amino acids)

>PS417_14770 MarR family transcriptional regulator (Pseudomonas simiae WCS417)
MSTPLLVERAGIVRSFNRFYTHQIGVLQEHLLQSDYSLTEIRVMYELSTRGDLTSADLCQ
MLSLDAGYLSRLTSGFEKKGLIQKVRSATDARAVQLHLTDHGRAVLKPLEQQTQNEVITL
LENLPEPQQRQLTDAMKRIQALLQGTAPNYLLRDPQPGDMGVVVQQQTALYAREYGWNWE
FEALVAETVAKYLRAFDPTCERCWIAEKDAEVVGSVFVIRHDDTTAKLRMLYVDASARGM
GIGQRLVDECVRFARQVGYQRMQLWTVDVLSDARKLYQKAGFELVEEETMDSFGKSLVSQ
TWARAL