Protein Info for GFF2880 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: 4-alpha-L-fucosyltransferase (EC 2.4.1.-)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 359 PF07429: Glyco_transf_56" amino acids 1 to 355 (355 residues), 609.1 bits, see alignment E=1.4e-187

Best Hits

Swiss-Prot: 100% identical to WECF_SALTY: TDP-N-acetylfucosamine:lipid II N-acetylfucosaminyltransferase (wecF) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K12582, TDP-Fuc4NAc transferase [EC: 2.4.1.-] (inferred from 100% identity to stm:STM3927)

MetaCyc: 83% identical to TDP-N-acetylfucosamine:lipid II N-acetylfucosaminyltransferase (Escherichia coli K-12 substr. MG1655)
FUC4NACTRANS-RXN [EC: 2.4.1.325]

Predicted SEED Role

"4-alpha-L-fucosyltransferase (EC 2.4.1.-)" (EC 2.4.1.-)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.4.1.-

Use Curated BLAST to search for 2.4.1.- or 2.4.1.325

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (359 amino acids)

>GFF2880 4-alpha-L-fucosyltransferase (EC 2.4.1.-) (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MTVLIHVLGSDIPHHNHTVLRFFNDTLAATSEHAREFMVAGEDNGFTESCPALSLRFYGS
KKALAQAVIAKAKANRRQRFFFHGQFNTSLWLALLSGGIKPAQFYWHIWGADLYEVSHGL
KFRLFYPLRRIAQGRVGGVFATRGDLSYFARQHPDVRGELLYFPTRMDPSLNAMAKERQR
AGKLTILVGNSGDRSNQHIAALRAVYQQFGDTVNVVVPMGYPANNQDYIDEVRQAGLALF
SAENLQILSEKMEFDAYLALLRQCDLGYFIFARQQGIGTLCLLIQADIPCVLNRDNPFWQ
DMAEQHLPVLFTTDDLNEQVVREAQRQLASVDKSGITFFSPNYLQPWHNALRIAAGEAE