Protein Info for PS417_14710 in Pseudomonas simiae WCS417
Annotation: isochorismatase
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 39% identical to Y2328_HALVD: Uncharacterized isochorismatase family protein HVO_2328 (HVO_2328) from Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2)
KEGG orthology group: K05993, isochorismatase [EC: 3.3.2.1] (inferred from 86% identity to pfs:PFLU3415)Predicted SEED Role
"Amidases related to nicotinamidase" in subsystem NAD and NADP cofactor biosynthesis global
MetaCyc Pathways
- superpathway of chorismate metabolism (44/59 steps found)
- 2,3-dihydroxybenzoate biosynthesis (2/3 steps found)
- enterobactin biosynthesis (5/11 steps found)
- vibriobactin biosynthesis (2/9 steps found)
- bacillibactin biosynthesis (4/12 steps found)
KEGG Metabolic Maps
Isozymes
Compare fitness of predicted isozymes for: 3.3.2.1
Use Curated BLAST to search for 3.3.2.1
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See A0A1N7ULM8 at UniProt or InterPro
Protein Sequence (186 amino acids)
>PS417_14710 isochorismatase (Pseudomonas simiae WCS417) MQPLATNAALLIIDMQQGMNEPKLGRRNNADAEVQMQRLLKAWRQSNRPVVHIRHMSRSP DSVFWPGQPGCEFQPALQPLALEHVVEKNVPDAFTATGLERWLHVRGIRQLVIAGVITNN SVESTARSGGNLGFAVTVVSDACYTFDQVDLSGRLWPAEDVHALSLSNLAMDYAGVVETD EILAHC