Protein Info for GFF2877 in Variovorax sp. SCN45

Annotation: Ribonuclease BN

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 315 transmembrane" amino acids 34 to 60 (27 residues), see Phobius details amino acids 103 to 127 (25 residues), see Phobius details amino acids 147 to 170 (24 residues), see Phobius details amino acids 190 to 210 (21 residues), see Phobius details amino acids 222 to 243 (22 residues), see Phobius details amino acids 255 to 279 (25 residues), see Phobius details TIGR00765: YihY family inner membrane protein" amino acids 20 to 281 (262 residues), 86.1 bits, see alignment E=1.7e-28 PF03631: Virul_fac_BrkB" amino acids 31 to 285 (255 residues), 114.7 bits, see alignment E=3e-37

Best Hits

KEGG orthology group: None (inferred from 92% identity to vpe:Varpa_1938)

Predicted SEED Role

"Ribonuclease BN (EC 3.1.-.-)" in subsystem LMPTP YfkJ cluster or tRNA processing (EC 3.1.-.-)

Isozymes

Compare fitness of predicted isozymes for: 3.1.-.-

Use Curated BLAST to search for 3.1.-.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (315 amino acids)

>GFF2877 Ribonuclease BN (Variovorax sp. SCN45)
MTTSNPLQHAAPLLRHPLRFVWQALKEFRANQGLLLAGAVAYYALLSIVPLLIVSVIALS
HVIEQAELLRTIGRYLEWLLPGQSKAIVAELSGFLDHRDVLGPVLLVTMIFFSSLAFSVL
ESAMAVFFHHRKADHKRHFLVSVAMPYIYILCLCVGLLLVTLVSGALQLVGQESVDLLGR
SWSLSGISGLLLYLLGLGGEIFMLTSLYLVMPAGRMSLRHALLGGVTAALLWEATRRVLI
WYFSTLSQVNVVYGSLTTAIVVLLSLEIAATLVLLGAQVIAQYERLDRTGSLRPPEPAVS
GEPIESLRPDESPRR