Protein Info for GFF2874 in Pseudomonas sp. DMC3

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 275 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details transmembrane" amino acids 30 to 52 (23 residues), see Phobius details amino acids 59 to 78 (20 residues), see Phobius details amino acids 101 to 132 (32 residues), see Phobius details amino acids 141 to 158 (18 residues), see Phobius details amino acids 170 to 191 (22 residues), see Phobius details amino acids 203 to 224 (22 residues), see Phobius details amino acids 231 to 252 (22 residues), see Phobius details PF00892: EamA" amino acids 6 to 129 (124 residues), 28.8 bits, see alignment E=7e-11 amino acids 144 to 274 (131 residues), 42.3 bits, see alignment E=4.7e-15

Best Hits

KEGG orthology group: None (inferred from 72% identity to pfs:PFLU3331)

Predicted SEED Role

"Permeases of the drug/metabolite transporter (DMT) superfamily"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (275 amino acids)

>GFF2874 hypothetical protein (Pseudomonas sp. DMC3)
MPIHLVLLVLFAALLHASWNALLRGGADRLWSMTIMCVAIAIVCLIATFFMAAPAPESWG
YALLSALLHVGYNLFLVRSYRVGDLGQIYPISRGSSPALITLGAALFVGETITPAELLGI
GLVSGGIISLAFRGRSLSVPSLPYALGTGCFIAAYSMVDGIGARLSGAPLAYTVWMSALW
GVLMPLVYIGLRDARSLFSVRPGMLTAAVGGLVSLLAYAIVIYAMNEAPLGAVSALRETS
VLFAALLGYLFLGEKLTVRRMLACVVIASGAIIIG