Protein Info for GFF2873 in Variovorax sp. SCN45

Annotation: Propionyl-CoA thioesterase activity

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF20791: Acyl-ACP_TE_C
  • amino acids 18 to 48 (31 residues), 28.1 bits, 3e-10
• PF13279: 4HBT_2
  • amino acids 24 to 140 (117 residues), 63.5 bits, E=3.9e-21
• PF03061: 4HBT
  • amino acids 31 to 111 (81 residues), 58 bits, E=1.4e-19

Best Hits

KEGG orthology group: K07107, acyl-CoA thioester hydrolase [EC: 3.1.2.-] (inferred from 94% identity to vap:Vapar_1769)

Predicted SEED Role

"Propionyl-CoA thioesterase activity"

KEGG Metabolic Maps

• Benzoate degradation via CoA ligation
• Biosynthesis of plant hormones
• Biosynthesis of unsaturated fatty acids
• Fatty acid biosynthesis
• Limonene and pinene degradation
• Ubiquinone and menaquinone biosynthesis
• alpha-Linolenic acid metabolism

Isozymes

Compare fitness of predicted isozymes for: 3.1.2.-

Use Curated BLAST to search for 3.1.2.-

Protein Sequence (147 amino acids)

>GFF2873 Propionyl-CoA thioesterase activity (Variovorax sp. SCN45)
MSATTKPTPHARNGYRAFRSIPTRWADNDMYGHVNNVVYYSWFDTAVNALLIERGALDIH
DGQTIGFVVETQCNYFAPIAFPQTVEAGIRVAQAGRSSVRYEIALFAEGSDSAAAQGHFI
HVYVDRATQRPVPLPEALQRVVDSLKA