Protein Info for GFF2872 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Branched-chain amino acid transport system permease protein LivM (TC 3.A.1.4.1)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 330 signal peptide" amino acids 1 to 19 (19 residues), see Phobius details transmembrane" amino acids 28 to 48 (21 residues), see Phobius details amino acids 56 to 73 (18 residues), see Phobius details amino acids 79 to 99 (21 residues), see Phobius details amino acids 106 to 124 (19 residues), see Phobius details amino acids 155 to 175 (21 residues), see Phobius details amino acids 204 to 228 (25 residues), see Phobius details amino acids 240 to 267 (28 residues), see Phobius details amino acids 276 to 294 (19 residues), see Phobius details PF02653: BPD_transp_2" amino acids 29 to 288 (260 residues), 140.1 bits, see alignment E=4e-45

Best Hits

KEGG orthology group: K01998, branched-chain amino acid transport system permease protein (inferred from 79% identity to lch:Lcho_3688)

Predicted SEED Role

"Branched-chain amino acid transport system permease protein LivM (TC 3.A.1.4.1)" in subsystem ABC transporter branched-chain amino acid (TC 3.A.1.4.1) (TC 3.A.1.4.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (330 amino acids)

>GFF2872 Branched-chain amino acid transport system permease protein LivM (TC 3.A.1.4.1) (Hydrogenophaga sp. GW460-11-11-14-LB1)
MKKTTLAALVLCAAALLAAPHFMKNYGIYLLSYWLVFIIATMGLNLTVGYAGQKSLGHAA
FFGIGAYTVAIMMKAGLSFWLGLPTAMLICFVVGIILGFPALRVQTIYLAFATLGFNTAV
WLVMRNEEWLTGGTFGINNIARPGLFGLSLEGNLAYYHFVLAVTVLLAALLWWLLRSPWG
KAFTALRDNPIRAESLGVDTRSYTLLAFAIGAVYAGVAGALFASLVQFIEPAPFTVGASI
MMYLMVVVGGPGYFLGPVLGAAVGVILPEWLRFAQAWYLFVFGGAVVLLMIWLPDGLLSI
PERIRARRLAREASAARQAAAQAASQGVKA