Protein Info for GFF2861 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Hydroxymethylpyrimidine ABC transporter, transmembrane component

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 273 transmembrane" amino acids 21 to 46 (26 residues), see Phobius details amino acids 68 to 94 (27 residues), see Phobius details amino acids 106 to 126 (21 residues), see Phobius details amino acids 132 to 154 (23 residues), see Phobius details amino acids 186 to 210 (25 residues), see Phobius details amino acids 235 to 256 (22 residues), see Phobius details PF00528: BPD_transp_1" amino acids 84 to 260 (177 residues), 79.3 bits, see alignment E=1.6e-26

Best Hits

KEGG orthology group: K02050, sulfonate/nitrate/taurine transport system permease protein (inferred from 63% identity to hse:Hsero_0462)

Predicted SEED Role

"Hydroxymethylpyrimidine ABC transporter, transmembrane component" in subsystem Thiamin biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (273 amino acids)

>GFF2861 Hydroxymethylpyrimidine ABC transporter, transmembrane component (Hydrogenophaga sp. GW460-11-11-14-LB1)
MKSPDISRNAARQVNWGSSKLPVLAIGVGLLALWQLVVVALSLPVYVLPGPLDVLKALYA
DSDLLFTGLLFTLKVTVLAFAVAVLLGVSISFLLSQSRLLEKSVMPYMVILQVTPIVAIA
PLIIIWVSNTFVALVTIASITALFPIVSNMTLGLRSVAPNLQSLFRIYRASNWQTLTRLK
LKAALPYFFAGARISSGLALIGAVVAEFVAGTGGTQSGLAYIILESGVQLKVPRMFASLL
LISLTGIALFALMVFISNRVLGAWHESTVKTEH