Protein Info for GFF2859 in Xanthobacter sp. DMC5

Annotation: Benzoate 1,2-dioxygenase electron transfer component

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 340 transmembrane" amino acids 209 to 228 (20 residues), see Phobius details PF00111: Fer2" amino acids 10 to 86 (77 residues), 58.9 bits, see alignment E=5.8e-20 PF00970: FAD_binding_6" amino acids 120 to 200 (81 residues), 46.6 bits, see alignment E=5.7e-16 PF00175: NAD_binding_1" amino acids 211 to 312 (102 residues), 62.5 bits, see alignment E=8.3e-21

Best Hits

Swiss-Prot: 53% identical to XYLZ_PSEPU: Toluate 1,2-dioxygenase electron transfer component (xylZ) from Pseudomonas putida

KEGG orthology group: K05784, benzoate 1,2-dioxygenase electron transfer component (inferred from 76% identity to pde:Pden_1179)

MetaCyc: 53% identical to XylZ (Pseudomonas putida mt-2)
Benzoate 1,2-dioxygenase. [EC: 1.14.12.10]

Predicted SEED Role

No annotation

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.14.12.10

Use Curated BLAST to search for 1.14.12.10

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (340 amino acids)

>GFF2859 Benzoate 1,2-dioxygenase electron transfer component (Xanthobacter sp. DMC5)
MSSHTIALNFEDGVTRIIDCKAGEKLLDAAFRNKINLPMDCSDGVCGTCKCRAESGAYDL
GEDYIEDALTADEAAQGLVLTCQMVPSSDCIIAVPVSSLSCKTGLQRFTATVAQVSLHND
AAVVLELDVDGPAPAFLPGQYVNIDVPGTGLTRAYSFSSAPGETHISFLIKRIPGGLMSS
WLARAKPGERLTLSGPLGSFYLRDTSAPLLFLAGGTGLAPFLSMLEVLAHAGSQQQIHLV
YGVTRDLDLVLVNALEAYTPRLPGFSFTTVVADEASAHPRKGWVTQHMPDDMLRAAPGVY
LCGPPPMVDAVRRHFEATGVTPNCFHYEKFTPNAPLKESA