Protein Info for GFF2859 in Variovorax sp. SCN45

Annotation: Excinuclease ABC subunit C

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 655 TIGR00194: excinuclease ABC subunit C" amino acids 10 to 479 (470 residues), 423 bits, see alignment E=1e-130 PF01541: GIY-YIG" amino acids 21 to 95 (75 residues), 40.1 bits, see alignment E=9.4e-14 PF02151: UVR" amino acids 207 to 238 (32 residues), 27.6 bits, see alignment (E = 4.7e-10) PF08459: UvrC_RNaseH_dom" amino acids 416 to 587 (172 residues), 155.3 bits, see alignment E=3e-49 PF14520: HHH_5" amino acids 604 to 654 (51 residues), 33.6 bits, see alignment 1.1e-11

Best Hits

KEGG orthology group: K03703, excinuclease ABC subunit C (inferred from 94% identity to vap:Vapar_1783)

Predicted SEED Role

"Excinuclease ABC subunit C" in subsystem DNA repair, UvrABC system

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (655 amino acids)

>GFF2859 Excinuclease ABC subunit C (Variovorax sp. SCN45)
MSDVHSDQLLSEVAALPQLPGVYRYFDAAGAVLYVGKARNLRKRVANYFQKNHGGTRIGH
MISKIVRMETTVVRSEAEALLLENNLIKTLKPRYNILFRDDKSYPYLKIASHQFPRLAYY
RGAVDKKHRYFGPYPSAWAVKESIQLLQKVFRLRTCEDTVYANRTRPCLLYQIKRCSGPC
VGHIAPDAYAQDVASAEAFLMGDTQLVLSKLEQRMMTHAEKLEFEQAAELRNQMSAISRV
LHQQSIEIASDKDVDILAVKVQGGKACVNLAMVRGGRHLGDRPYFPVHVEDAVQIHHGEL
DGDEGDDAGPAAADPIEVQVLEAFIAQHYIDVPVPATLVLSQQVSRELIEAISQQAGSRV
TAVFQPREQRRHWLEMAETNAGLQLARLLAEEGSQQARTRALTDALELASDDLDTFRVEC
FDISHTAGEATQASCVVFEHHAMQNKEYRRYNIEGITPGDDYAAMRQVLHRRYGKLAEAM
AAETDALPPGDAESESADAPPKPRTARMPDLVLVDGGKGQVSMAREVFGELGLPLSLIVG
VEKGEGRKVGLEELVFADGREKVYLGKDSAALMLVAQIRDEAHRFAITGMRAKRAKVRVG
GSQLEDIPGIGPKRRARLLQRFGGIRGVAAASVEDIASVEGIASDLAEEIYKALH