Protein Info for GFF2857 in Variovorax sp. SCN45

Annotation: Permease of the drug/metabolite transporter (DMT) superfamily

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 295 transmembrane" amino acids 12 to 33 (22 residues), see Phobius details amino acids 45 to 66 (22 residues), see Phobius details amino acids 73 to 95 (23 residues), see Phobius details amino acids 101 to 119 (19 residues), see Phobius details amino acids 131 to 149 (19 residues), see Phobius details amino acids 155 to 176 (22 residues), see Phobius details amino acids 188 to 207 (20 residues), see Phobius details amino acids 221 to 241 (21 residues), see Phobius details amino acids 248 to 268 (21 residues), see Phobius details amino acids 274 to 291 (18 residues), see Phobius details PF00892: EamA" amino acids 21 to 145 (125 residues), 50.4 bits, see alignment E=1.4e-17 amino acids 161 to 291 (131 residues), 52.4 bits, see alignment E=3.5e-18

Best Hits

KEGG orthology group: None (inferred from 88% identity to vpe:Varpa_1960)

Predicted SEED Role

"Permease of the drug/metabolite transporter (DMT) superfamily" in subsystem Queuosine-Archaeosine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (295 amino acids)

>GFF2857 Permease of the drug/metabolite transporter (DMT) superfamily (Variovorax sp. SCN45)
MTSAAPARNAGWLRAMPGVFVLIWSTGFIVARYGMPYAPPLKFLAVRYALSLVCFGAWVA
LARVAWPKQRAQWGHLAVTGVLMQAGYLGGVWAAVHEGMGAGLVALLVGIQPVLTAVWLS
FNGGRISKRQWGGLALGFAGLVLVVSRKLGQGAEVSALTMGLALMALLSITAGTLYQKRF
VAPCDVRSASAVQMAAALLVTLPFAALEPQHIEWNLQSGGAMAWSVLALSLGGSSLLYML
IQRGTATAVTSLLYLVPPCTAVMAWLLFSEPITLVTVLGIALTAVGVSLVVRGER