Protein Info for PS417_14565 in Pseudomonas simiae WCS417

Annotation: chemotaxis protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 497 transmembrane" amino acids 16 to 35 (20 residues), see Phobius details amino acids 41 to 59 (19 residues), see Phobius details amino acids 65 to 83 (19 residues), see Phobius details amino acids 88 to 105 (18 residues), see Phobius details amino acids 109 to 128 (20 residues), see Phobius details amino acids 143 to 166 (24 residues), see Phobius details PF00015: MCPsignal" amino acids 282 to 462 (181 residues), 138.6 bits, see alignment E=9.8e-45

Best Hits

KEGG orthology group: K03406, methyl-accepting chemotaxis protein (inferred from 93% identity to pfs:PFLU3379)

Predicted SEED Role

"Methyl-accepting chemotaxis protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7TZT2 at UniProt or InterPro

Protein Sequence (497 amino acids)

>PS417_14565 chemotaxis protein (Pseudomonas simiae WCS417)
MPTRTRFFEHYRKADRIMLALVWLMFLFSLGLAFWHDTLMQAIIVGGSTSVVLTLLYRAI
GGSRVMRCALGAGLMVMAALHINQAQGVIESHFGIFALLAVLTFYRDWLPILVAAATIAV
HHVVFHALQHQGVPVFVMEHHGGWTMVFVHAFYVVMETVALLYLAVHSQAEAVESQEMLE
KMLSVTTQISAQTAQGEGKVHMSLAKRFDHFLQQITHLIDGVARDSHGLGQLGQELASAS
GTLEKGARHQLAEITQMTGSMQRMEDAMGHIAVHVEQAVDHAGKASQQILRGQESVGRAQ
QEITQLASRLNGTHETVQGLAVQAEQIGTVLDVISGIANQTNLLALNAAIEAARAGEQGR
GFAVVADEVRNLAQRTAVSTQEIKTIIESLQHGSRQAVEAMHDSRQGVDRCVEDSQVAVD
MLRAVGSDIAQIDDLNGRIVTTTREQTEANLEIVGRLQSVQSIAQSTANDVETLARSSEQ
LPPIAVRLDALGRRFHQ